Scaffold JCVI_READ_1317812

Overview

Basic Information

• Taxon OID: 2166559018
• Scaffold ID: JCVI_READ_1317812
• Source Dataset Name: Marine microbial communities from the Atlantic Ocean, for comparison studies - Ocean6 (GOS4441574)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: 454 Life Sciences
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 959
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Environmental And Host-Associated → Microbial Communities From The Atlantic Ocean And Human Feces From France, Grouped Together For A Comparative Study

Source Dataset Sampling Location

• Location Name: Atlantic Ocean
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004764	Metagenome / Metatranscriptome	424	Y

Sequences

Protein ID	Family	RBS	Sequence
Ocean6-_02532700	F004764	AGGAGG	MNYANFGLEKNVEILSAHHVERFTHLRDNEQYQDADSIAQEYVCKGEVENDNYQWLYVNYQFEEAN