Scaffold JCVI_READ_1313023

Overview

Basic Information

• Taxon OID: 2166559018
• Scaffold ID: JCVI_READ_1313023
• Source Dataset Name: Marine microbial communities from the Atlantic Ocean, for comparison studies - Ocean6 (GOS4441574)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: 454 Life Sciences
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 987
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Podivirus → Podivirus S05C243 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Environmental And Host-Associated → Microbial Communities From The Atlantic Ocean And Human Feces From France, Grouped Together For A Comparative Study

Source Dataset Sampling Location

• Location Name: Atlantic Ocean
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F082815	Metagenome / Metatranscriptome	113	Y

Sequences

Protein ID	Family	RBS	Sequence
Ocean6-_01899050	F082815	N/A	MRIFAAIERILLDRWSKMKIALKINKWPLLNYREQQLQLKKQYLESLLDKK