| Basic Information | |
|---|---|
| Taxon OID | 2166559018 Open in IMG/M |
| Scaffold ID | JCVI_READ_1214439 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from the Atlantic Ocean, for comparison studies - Ocean6 (GOS4441574) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | 454 Life Sciences |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 898 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Environmental And Host-Associated → Microbial Communities From The Atlantic Ocean And Human Feces From France, Grouped Together For A Comparative Study |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Atlantic Ocean | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F013096 | Metagenome / Metatranscriptome | 274 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ocean6-_00969410 | F013096 | N/A | MLTDTVSDRAVGLSTLSHTKTVASYEPEVDGIHDNAGLNDCPAAS |
| ⦗Top⦘ |