Basic Information | |
---|---|
Taxon OID | 2166559018 Open in IMG/M |
Scaffold ID | JCVI_READ_1014885 Open in IMG/M |
Source Dataset Name | Marine microbial communities from the Atlantic Ocean, for comparison studies - Ocean6 (GOS4441574) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | 454 Life Sciences |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 996 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Environmental And Host-Associated → Microbial Communities From The Atlantic Ocean And Human Feces From France, Grouped Together For A Comparative Study |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Atlantic Ocean | |||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F018615 | Metagenome | 234 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ocean6-_01638340 | F018615 | AGG | MKKLILLLIILSSCSTPHTRSDAYYEAVAGHIVQTVLSGDCDSKCISSIVNSDLKYATYTQVVIVIDKVSKSLPSIYDGFKNDLKKKVRKKKKSPR |
⦗Top⦘ |