Basic Information | |
---|---|
Taxon OID | 2166559017 Open in IMG/M |
Scaffold ID | JCVI_READ_957535 Open in IMG/M |
Source Dataset Name | Marine microbial communities from the Atlantic Ocean, for comparison studies - Ocean5 (GOS 4441573) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | 454 Life Sciences |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 998 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Environmental And Host-Associated → Microbial Communities From The Atlantic Ocean And Human Feces From France, Grouped Together For A Comparative Study |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Maryland: Natonal Institute of Health | |||||||
Coordinates | Lat. (o) | 39.0042816 | Long. (o) | -77.1012173 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F007318 | Metagenome / Metatranscriptome | 353 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ocean5-_02394450 | F007318 | N/A | MMNRPEILIKSYIKKKTEFTVFFETVTIIAETIAISENI |
⦗Top⦘ |