| Basic Information | |
|---|---|
| Taxon OID | 2166559017 Open in IMG/M |
| Scaffold ID | JCVI_READ_838855 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from the Atlantic Ocean, for comparison studies - Ocean5 (GOS 4441573) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | 454 Life Sciences |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 984 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Environmental And Host-Associated → Microbial Communities From The Atlantic Ocean And Human Feces From France, Grouped Together For A Comparative Study |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Maryland: Natonal Institute of Health | |||||||
| Coordinates | Lat. (o) | 39.0042816 | Long. (o) | -77.1012173 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F033050 | Metagenome / Metatranscriptome | 178 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ocean5-_01401060 | F033050 | AGG | VAKLLLHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVKNDYRSFG |
| ⦗Top⦘ |