Basic Information | |
---|---|
Taxon OID | 2166559017 Open in IMG/M |
Scaffold ID | JCVI_READ_797746 Open in IMG/M |
Source Dataset Name | Marine microbial communities from the Atlantic Ocean, for comparison studies - Ocean5 (GOS 4441573) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | 454 Life Sciences |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 964 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Environmental And Host-Associated → Microbial Communities From The Atlantic Ocean And Human Feces From France, Grouped Together For A Comparative Study |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Maryland: Natonal Institute of Health | |||||||
Coordinates | Lat. (o) | 39.0042816 | Long. (o) | -77.1012173 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F011766 | Metagenome | 287 | Y |
F092221 | Metagenome | 107 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ocean5-_00142150 | F092221 | GGTGG | MAFEIKGFGEPSKFNFKSFKNFNNNPKKEGIYPRGSDGYQLESEVKFYNQDSLWTRWRRGYELYVMMQTILGSTSKERDRRGDYRLFFTFQQFPGVFIPARIFTFPSKNKELGEHVCGMRDTDGFSFYNFGLPILAVRYLAPSVDATYQQTGTTLVVTKTDHGLFPGDDVFLDISTGTGIDETSRDCK |
Ocean5-_00142160 | F011766 | N/A | VNTETVTNINQFFPLFVASVDCSQQSYSLSEQKILPFINHPTVQAGANFGSANNALAPKQRGLMLKRGQALYVAASGATALTNGFYCNVQGGFY |
⦗Top⦘ |