| Basic Information | |
|---|---|
| Taxon OID | 2166559013 Open in IMG/M |
| Scaffold ID | NCBI_BBAY_READ_1106073147036 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from the Atlantic Ocean, for comparison studies - Ocean1 (Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY01 3688) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | 454 Life Sciences |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 989 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Environmental And Host-Associated → Microbial Communities From The Atlantic Ocean And Human Feces From France, Grouped Together For A Comparative Study |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Atlantic Ocean | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F007086 | Metagenome / Metatranscriptome | 358 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ocean1-_00034280 | F007086 | N/A | MTKRELYDIIDEEIQNVKLDRITEEITNDDEKVIRELIRQEVSAIFFDLFKKRKMWGA |
| ⦗Top⦘ |