Basic Information | |
---|---|
Taxon OID | 2166559013 Open in IMG/M |
Scaffold ID | NCBI_BBAY_READ_1106073079683 Open in IMG/M |
Source Dataset Name | Marine microbial communities from the Atlantic Ocean, for comparison studies - Ocean1 (Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY01 3688) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | 454 Life Sciences |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 966 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Environmental And Host-Associated → Microbial Communities From The Atlantic Ocean And Human Feces From France, Grouped Together For A Comparative Study |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Atlantic Ocean | |||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F028615 | Metagenome / Metatranscriptome | 191 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ocean1-_00096940 | F028615 | GGA | LDKQYIQAIIETIQKIVGPILVKPFVDFKKPLEVIPRTIANRRNIYPEKLLTIKPMTI |
⦗Top⦘ |