Scaffold cont_contig90109

Overview

Basic Information

• Taxon OID: 2166559005
• Scaffold ID: cont_contig90109
• Source Dataset Name: Simulated microbial communities from Lyon, France
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: 454 Life Sciences
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 631
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated → Simulated Microbial Communities From Lyon, France

Source Dataset Sampling Location

• Location Name: Lyon, France
• Coordinates
  • Lat. (^o): 45.7580538
  • Long. (^o): 4.7649095

Associated Families

Family	Category	Number of Sequences	3D Structure?
F048816	Metagenome	147	Y

Sequences

Protein ID	Family	RBS	Sequence
cont_0109.00005950	F048816	GGAGG	MLPIALCIMLLLLLSPVAQAPFVAPAAAQTQTKAQPQSREALYLKCRNAIFRKYGQSGAVYSVGPRYLVLPYTSGSRIDQCVANGGRVD