Basic Information | |
---|---|
Taxon OID | 2166559005 Open in IMG/M |
Scaffold ID | cont_contig72867 Open in IMG/M |
Source Dataset Name | Simulated microbial communities from Lyon, France |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | 454 Life Sciences |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 724 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated → Simulated Microbial Communities From Lyon, France |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Lyon, France | |||||||
Coordinates | Lat. (o) | 45.7580538 | Long. (o) | 4.7649095 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F036743 | Metagenome / Metatranscriptome | 169 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
cont_0867.00004670 | F036743 | N/A | LTLSAGFGLAGCAAIDDLKVSIFQWLDPVNFTGEGEELLGYAPETRLIPPAEIPKQAAKAPSKRIKPATRKLQRPQTVVLPPKKPPISDSPETATPGETEGQSAWPHSMRSRTPNPEAPPFFDERFCAECWGLPAKAE |
⦗Top⦘ |