| Basic Information | |
|---|---|
| Taxon OID | 2166559005 Open in IMG/M |
| Scaffold ID | cont_contig71663 Open in IMG/M |
| Source Dataset Name | Simulated microbial communities from Lyon, France |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | 454 Life Sciences |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 730 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated → Simulated Microbial Communities From Lyon, France |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lyon, France | |||||||
| Coordinates | Lat. (o) | 45.7580538 | Long. (o) | 4.7649095 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F103375 | Metagenome / Metatranscriptome | 101 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| cont_0663.00004640 | F103375 | N/A | MPSVPTPEGRRSKRVMLKRRASLVVNLDRDEKRLPCLVLDSSKEGYRLRGNFHLRRGQFVEIVFDPEPFR |
| ⦗Top⦘ |