Scaffold cont_contig57301

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold cont_contig57301

Scaffold cont_contig57301

Overview

Basic Information
Taxon OID	2166559005 Open in IMG/M
Scaffold ID	cont_contig57301 Open in IMG/M
Source Dataset Name	Simulated microbial communities from Lyon, France
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	454 Life Sciences
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	809
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated → Simulated Microbial Communities From Lyon, France

Source Dataset Sampling Location
Location Name	Lyon, France
Coordinates	Lat. (^o)	45.7580538	Long. (^o)	4.7649095	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F040219	Metagenome	162	Y

Sequences

Protein ID	Family	RBS	Sequence
cont_0301.00003850	F040219	N/A	MPVTSVIEAPREAAQSASRPETFRLPKAAERDPFFGFSRTFYYEGEHRGYWRLIRIRERGKLRGVTLVPFDAVARFVQSQMEAAK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.