NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold SwBSRL2_contig_2285477

Scaffold SwBSRL2_contig_2285477


Overview

Basic Information
Taxon OID2162886013 Open in IMG/M
Scaffold IDSwBSRL2_contig_2285477 Open in IMG/M
Source Dataset NameSwitchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)1404
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere → Switchgrass Rhizosphere Microbial Communities From Michigan, Usa

Source Dataset Sampling Location
Location NameEast Lansing, MI
CoordinatesLat. (o)42.794771Long. (o)-84.393804Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F033479Metagenome / Metatranscriptome177Y
F054961Metagenome / Metatranscriptome139Y

Sequences

Protein IDFamilyRBSSequence
SwBSRL2_0468.00003370F033479GGAMLPAIALAGCATTSSSLVRGMTAPNPSGCYIQVFDGERLRGVADFINGPMRYSSLSRLPNGTDWTGRIRSIEVGPAATATIWTEVNQSGQSMNLLLDRRYPALPEDFSGKVRSMELRCEESRLASEHEPSSSSVTK
SwBSRL2_0468.00003380F054961GGAMRRYLHAFIAALTMCLLTVVDGARAQTPEHRFAPGTPPIAVRPSALAQIVSELAGSPVNVQRARILWVIDSHAVVIESDSAFDPTWRDRGRVLVMLERSRSLSIPRPPVSIAPVNVLGIARTLLGIQAAQDVPWPQALTRREIERLGIRAAILATSVRTSDGVELTSSTAAP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.