| Basic Information | |
|---|---|
| Taxon OID | 2149837016 Open in IMG/M |
| Scaffold ID | STU__NODE_988_len_4117_cov_12_632257 Open in IMG/M |
| Source Dataset Name | Human fecal microbial communities from the University of Arizona (HMP) - Ef2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Chinese National Human Genome Center, Beijing |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4145 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (57.14%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From The University Of Arizona, For Hmp Training |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Bording, Denmark | |||||||
| Coordinates | Lat. (o) | 56.13 | Long. (o) | 9.24 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F083451 | Metagenome | 113 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| STU_0867.00000060 | F083451 | N/A | MDKNEREKQVLDLLMSRKDIRKLVEKSNECYSKMDFVGAMKCRQEIKDIVDRESKIMLTKSESLVSLMNNADNEYKFNMLVWLHSMMCMADVFNGILEDFKDGVRKANGNSKFVKFDNLDRLMTECKKEIDYLMKGTSKSFQISFAVRSDELREMIENMVGDNIREGYDIFKEEAKMTKETDRSKIEEFNKRLDHE |
| ⦗Top⦘ |