Scaffold STU__NODE_6857_len_16142_cov_12_795998

Overview

Basic Information

• Taxon OID: 2149837016
• Scaffold ID: STU__NODE_6857_len_16142_cov_12_795998
• Source Dataset Name: Human fecal microbial communities from the University of Arizona (HMP) - Ef2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Chinese National Human Genome Center, Beijing
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 16170
• Total Scaffold Genes: 10
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (30.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From The University Of Arizona, For Hmp Training

Source Dataset Sampling Location

• Location Name: Bording, Denmark
• Coordinates
  • Lat. (^o): 56.13
  • Long. (^o): 9.24

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050794	Metagenome	145	N

Sequences

Protein ID	Family	RBS	Sequence
STU_0620.00000210	F050794	AGG	MMLYTSNYFVKVRQKQLLDHTYSLSRDQAFDYMTEFNKRLSDKVGIKCTMDILLPTDDDNANIIIEHNGIIKKLMKEAEKLELDTDAIKAMMRDLLDELKDDIDLNILIFDVTQLLIKYNLFRLDAITEQEFKNSFVRMDSRNMEIKKLTLSDIKKVVEMIEDRYSYALYMTEEYG