Scaffold _GVICOHK01EF2WV

Overview

Basic Information

• Taxon OID: 2149837010
• Scaffold ID: _GVICOHK01EF2WV
• Source Dataset Name: Fresh water microbial communities from LaBonte Lake, Laramie, Wyoming, sample from pre-bloom
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 526
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Labonte Lake, Laramie, Wyoming, Usa

Source Dataset Sampling Location

• Location Name: LaBonte Lake, Laramie, Wyoming
• Coordinates
  • Lat. (^o): 41.321
  • Long. (^o): -105.586

Associated Families

Family	Category	Number of Sequences	3D Structure?
F065260	Metagenome / Metatranscriptome	128	Y

Sequences

Protein ID	Family	RBS	Sequence
LBLPr_02413620	F065260	N/A	YRDALICQLVEASWTYEAISNAANITRERVRQIANSDKEFAESLGITIPEPPTKPEPVKASYIEPSPETLARLLELQPYAQQVRSNGTRYRAEAEEYTALLNYAHTVEGVTLYRLGKRLGITHGAIRFRLVRYGYKKAPNATSKVYSPIIQKIV