| Basic Information | |
|---|---|
| Taxon OID | 2149837010 Open in IMG/M |
| Scaffold ID | LBLPr__contig00215 Open in IMG/M |
| Source Dataset Name | Fresh water microbial communities from LaBonte Lake, Laramie, Wyoming, sample from pre-bloom |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2067 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Labonte Lake, Laramie, Wyoming, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | LaBonte Lake, Laramie, Wyoming | |||||||
| Coordinates | Lat. (o) | 41.321 | Long. (o) | -105.586 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002502 | Metagenome / Metatranscriptome | 553 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| LBLPr_00478300 | F002502 | AGGA | MNAIEIGNTFTTQASGVTGVVQEIVKNASGSARVRLELPNGDTRWTTVK |
| ⦗Top⦘ |