Scaffold LBLPr__contig00059

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold LBLPr__contig00059

Scaffold LBLPr__contig00059

Overview

Basic Information
Taxon OID	2149837010 Open in IMG/M
Scaffold ID	LBLPr__contig00059 Open in IMG/M
Source Dataset Name	Fresh water microbial communities from LaBonte Lake, Laramie, Wyoming, sample from pre-bloom
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	4836
Total Scaffold Genes	13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	11 (84.62%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Labonte Lake, Laramie, Wyoming, Usa

Source Dataset Sampling Location
Location Name	LaBonte Lake, Laramie, Wyoming
Coordinates	Lat. (^o)	41.321	Long. (^o)	-105.586	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000264	Metagenome / Metatranscriptome	1424	Y

Sequences

Protein ID	Family	RBS	Sequence
LBLPr_01967070	F000264	AGGAG	MAAKLYTNKAWLTKRYLMDKKTPEAIAKECGTSVETIYVYLAKHGLRKSKR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.