NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold LBLPr__contig00051

Scaffold LBLPr__contig00051


Overview

Basic Information
Taxon OID2149837010 Open in IMG/M
Scaffold IDLBLPr__contig00051 Open in IMG/M
Source Dataset NameFresh water microbial communities from LaBonte Lake, Laramie, Wyoming, sample from pre-bloom
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5021
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (61.54%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Labonte Lake, Laramie, Wyoming, Usa

Source Dataset Sampling Location
Location NameLaBonte Lake, Laramie, Wyoming
CoordinatesLat. (o)41.321Long. (o)-105.586Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009505Metagenome / Metatranscriptome317Y
F076654Metagenome / Metatranscriptome118N

Sequences

Protein IDFamilyRBSSequence
LBLPr_01643160F076654GGAGMRLALVLLVAGCGPVTVSSVAYTTACPKGDRQCEIRQNAETLYYMAHGDAANELLCSGETRDVMGALCSIY
LBLPr_01643230F009505AGGAGMIGRMVGMLIGRKAKEKVVDAVLDKVNLPDPVETAIKVAATGNVGDLLGGMGKEMAQEAVLGAVLKKKPKK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.