Basic Information | |
---|---|
Taxon OID | 2149837002 Open in IMG/M |
Scaffold ID | Baltic_Sea__contig49124 Open in IMG/M |
Source Dataset Name | Marine microbial communities from the Baltic Sea |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Royal Institute of Technology |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 543 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Baltic Sea |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Baltic Sea | |||||||
Coordinates | Lat. (o) | 59.888937 | Long. (o) | 24.847412 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F067260 | Metagenome | 126 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Baltic_Sea_00062420 | F067260 | GGA | MSHFEKIVDPDLKRCETPEQMLQVLMYHYELDCKLGTITSLAFRQGLKAAVNMINPKAKTSSSALSH |
⦗Top⦘ |