| Basic Information | |
|---|---|
| Taxon OID | 2140918027 Open in IMG/M |
| Scaffold ID | contig07479 Open in IMG/M |
| Source Dataset Name | Hypersaline microbial communities from Antarctic Deep Lake - 36m 3.0um, 0.8um, 0.1um pool |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1173 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria → Halobacteriales | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline → Hypersaline Microbial Communities From Antarctic Deep Lake |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Deep Lake Antarctica | |||||||
| Coordinates | Lat. (o) | -68.54 | Long. (o) | 78.18 | Alt. (m) | Depth (m) | 36 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F027696 | Metagenome | 194 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| ADL36m2_02029740 | F027696 | N/A | KLSTVASELDICELGDERVIDFDIAANTDYEIQSCVIVDEDDRVIEAVVRFGRVEERPELGIDKSILYPAWANMVSDATNLEAVEGDLSDFSHIVPHLRVRRENVEKYGLETLSLDAFVTVVAELADLTEDILRGDDKTIDCQIDDYL |
| ⦗Top⦘ |