Scaffold contig04230

Overview

Basic Information

• Taxon OID: 2140918027
• Scaffold ID: contig04230
• Source Dataset Name: Hypersaline microbial communities from Antarctic Deep Lake - 36m 3.0um, 0.8um, 0.1um pool
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1774
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (83.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline → Hypersaline Microbial Communities From Antarctic Deep Lake

Source Dataset Sampling Location

• Location Name: Deep Lake Antarctica
• Coordinates
  • Lat. (^o): -68.54
  • Long. (^o): 78.18
  • Depth (m): 36

Associated Families

Family	Category	Number of Sequences	3D Structure?
F106195	Metagenome	100	N

Sequences

Protein ID	Family	RBS	Sequence
ADL36m2_00712120	F106195	GAGG	MDLSTDFFAKIAVQLIIQLAILAFFAGTVIQKIKSISDKIDRLEKKQNKYNKLISRMFVVESKVEDIKDDIQEVKNE