Scaffold Contig_360

Overview

Basic Information

• Taxon OID: 2140918017
• Scaffold ID: Contig_360
• Source Dataset Name: Hypersaline microbial communities from Antarctic Deep Lake - 24m 0.8um
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1028
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline → Hypersaline Microbial Communities From Antarctic Deep Lake

Source Dataset Sampling Location

• Location Name: Deep Lake Antarctica
• Coordinates
  • Lat. (^o): -68.54
  • Long. (^o): 78.18
  • Depth (m): 24

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020827	Metagenome	222	Y

Sequences

Protein ID	Family	RBS	Sequence
ADL24m8uC_00338920	F020827	GGAG	MNINDITGWYEIGQRWKLWKDGQLRDFYIDHIHVLESDDPDTIEVEHYLSDGTMITKLTVTASDVLPVVKNIEPVEKPDHL