Scaffold NODE_5601_length_2786_cov_8.064250

Overview

Basic Information

• Taxon OID: 2140918013
• Scaffold ID: NODE_5601_length_2786_cov_8.064250
• Source Dataset Name: Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2818
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (20.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa)

Source Dataset Sampling Location

• Location Name: Iowa, USA
• Coordinates
  • Lat. (^o): 41.827222
  • Long. (^o): -93.008611

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028126	Metagenome / Metatranscriptome	192	Y

Sequences

Protein ID	Family	RBS	Sequence
Iowa-Corn-GraphCirc_00894780	F028126	N/A	XXXVRLLDPAGKPIVVPDVLLVAHMADGTVENVPMGALPEPGTYRGTVPTDRSTPVGLRVRVRTGDQFVEVLVKP