NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold NODE_1976_length_2262_cov_9.757736

Scaffold NODE_1976_length_2262_cov_9.757736


Overview

Basic Information
Taxon OID2140918013 Open in IMG/M
Scaffold IDNODE_1976_length_2262_cov_9.757736 Open in IMG/M
Source Dataset NameSoil microbial communities from Great Prairies - Iowa soil (MSU Assemblies)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2294
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa)

Source Dataset Sampling Location
Location NameIowa, USA
CoordinatesLat. (o)41.827222Long. (o)-93.008611Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F082857Metagenome113Y
F093651Metagenome / Metatranscriptome106N

Sequences

Protein IDFamilyRBSSequence
Iowa-Corn-GraphCirc_01221550F093651N/AMAALLAISLACATRTASKDDLRVAHHPRNSNVISREELQDPAVAPNDAMTTIRLLRPAFFLTRGPLSIKNTTAGQLQISQDYGPLQKSSALSTIDTRSLVEVRYLNATDAQARFGINANGGPVLVLLTSTQ
Iowa-Corn-GraphCirc_01221570F082857GAGGMLHRVSRLSIAGLVAVAASCGGNRYPDTPGGAPAPSRVERQPNVITMEELQDPSIYSRDAYTAIRHLRPNFFTYHGPNSFQSSTGLLHLSLDYGPLQDLQQLAKMTTNGVLEVRYLNAEQAQARFGLNANGGPVIVLLYSKGAN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.