| Basic Information | |
|---|---|
| Taxon OID | 2140918002 Open in IMG/M |
| Scaffold ID | contig02076 Open in IMG/M |
| Source Dataset Name | Rhizosphere and bulk soil microbial communities from the Great Lakes - Sample MSB1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 941 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Loam → Unclassified → Rhizosphere And Bulk Soil → Rhizosphere And Bulk Soil Microbial Communities From The Great Lakes |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Rose Lake, Michigan, USA | |||||||
| Coordinates | Lat. (o) | 44.0647 | Long. (o) | -85.3817 | Alt. (m) | Depth (m) | 32 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F005950 | Metagenome / Metatranscriptome | 385 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| MSB1_00112100 | F005950 | GAG | MTYAKQKVKVKIHRTSDYDDKYTGIRDFPDEKAMLGYGLSKVHKVIIKKYTKDDEFMATARKTRGVKFDYDMELYDHTGTDVKESKILRKESN |
| ⦗Top⦘ |