Scaffold contig00488

Overview

Basic Information

• Taxon OID: 2140918002
• Scaffold ID: contig00488
• Source Dataset Name: Rhizosphere and bulk soil microbial communities from the Great Lakes - Sample MSB1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2215
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Loam → Unclassified → Rhizosphere And Bulk Soil → Rhizosphere And Bulk Soil Microbial Communities From The Great Lakes

Source Dataset Sampling Location

• Location Name: Rose Lake, Michigan, USA
• Coordinates
  • Lat. (^o): 44.0647
  • Long. (^o): -85.3817
  • Depth (m): 32

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033996	Metagenome / Metatranscriptome	176	N

Sequences

Protein ID	Family	RBS	Sequence
MSB1_00081760	F033996	N/A	MEFNLTAKDKHALKSLSGDLRDMFSMKRVEDRLEDPDPEYRKVFDATFFKTVEGNYLDEMLNWVEDFKKRLTEAESKQSKEELDLETKELLDAGWLIEQNKNDRNG