NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold contig00345

Scaffold contig00345


Overview

Basic Information
Taxon OID2140918002 Open in IMG/M
Scaffold IDcontig00345 Open in IMG/M
Source Dataset NameRhizosphere and bulk soil microbial communities from the Great Lakes - Sample MSB1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)630
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Unclassified → Rhizosphere And Bulk Soil → Rhizosphere And Bulk Soil Microbial Communities From The Great Lakes

Source Dataset Sampling Location
Location NameRose Lake, Michigan, USA
CoordinatesLat. (o)44.0647Long. (o)-85.3817Alt. (m)Depth (m)32
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005683Metagenome / Metatranscriptome393Y

Sequences

Protein IDFamilyRBSSequence
MSB1_00044210F005683N/AMEKSNGTMIMGILLVFGLGVYSIYFGQISFAEGVELKTVGKGAISCGNGEEVKGVRINFFVSYDGGTPFAEWNMDHKELGSAGGMITNVKTSSNSFVLKGFEAFDNICDVETPSDVKLSGNCGEGTVSLVSDNGNKGTFASNVKCG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.