Scaffold KansclcFeb2_ConsensusfromContig852590

Overview

Basic Information

• Taxon OID: 2124908045
• Scaffold ID: KansclcFeb2_ConsensusfromContig852590
• Source Dataset Name: Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 699
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa)

Source Dataset Sampling Location

• Location Name: Kansas, USA
• Coordinates
  • Lat. (^o): 39.1049
  • Long. (^o): -96.6054

Associated Families

Family	Category	Number of Sequences	3D Structure?
F005957	Metagenome / Metatranscriptome	385	Y

Sequences

Protein ID	Family	RBS	Sequence
KansclcFeb2_08921380	F005957	GGAG	MSTGSELSAGARLYALLAAIKRSPIVLRLAERVLLARDWASVRKSPDVDAYVLAWIASHVRGARRPRRMFM