| Basic Information | |
|---|---|
| Taxon OID | 2124908045 Open in IMG/M |
| Scaffold ID | KansclcFeb2_ConsensusfromContig57398 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 943 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Kansas, USA | |||||||
| Coordinates | Lat. (o) | 39.1049 | Long. (o) | -96.6054 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F053470 | Metagenome | 141 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| KansclcFeb2_05629970 | F053470 | AGGAG | MKVAQSLDHFVVPVDDLVIAEEFYARVFGGRITRRNGLNVRQRKRGAVPHTFIQIGGKRMGVYLQSEGRAEPAGARGLPTYSFTTTEGGLEEIVKDLNDLG |
| ⦗Top⦘ |