Scaffold A2_c1_ConsensusfromContig49933

Overview

Basic Information

• Taxon OID: 2124908043
• Scaffold ID: A2_c1_ConsensusfromContig49933
• Source Dataset Name: Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2247
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil → Soil Microbial Communities From Permafrost In Bonanza Creek, Alaska

Source Dataset Sampling Location

• Location Name: Bonanza creek, Alaska, USA
• Coordinates
  • Lat. (^o): 64.7
  • Long. (^o): -148.3
  • Depth (m): .3 to .7

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054239	Metagenome / Metatranscriptome	140	Y

Sequences

Protein ID	Family	RBS	Sequence
A2_c1_01233930	F054239	AGGAGG	MKAQPKSSHTQLNLPLLDATPVALPAGQDQQLIQALIELLRSAVSVPRAVKGEGHEPQTN