Scaffold B3_v_NODE_99401_len_5473_cov_14_489311

Overview

Basic Information

• Taxon OID: 2124908039
• Scaffold ID: B3_v_NODE_99401_len_5473_cov_14_489311
• Source Dataset Name: Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Bog Site B4
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 5523
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 8 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil → Soil Microbial Communities From Permafrost In Bonanza Creek, Alaska

Source Dataset Sampling Location

• Location Name: Bonanza creek, Alaska, USA
• Coordinates
  • Lat. (^o): 64.7
  • Long. (^o): -148.3
  • Depth (m): .3 to .7

Associated Families

Family	Category	Number of Sequences	3D Structure?
F034414	Metagenome	175	Y

Sequences

Protein ID	Family	RBS	Sequence
B3_v_00949370	F034414	GAG	MERDPAHVTVTPDPEETRRRLTSEVAEVESAISLVASGAASRITLSGLKFGEQLARRFQADAQSKGVRLDPLPFPEDAGCDLIVRRIDE