NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold B3_v_NODE_78965_len_12832_cov_13_489714

Scaffold B3_v_NODE_78965_len_12832_cov_13_489714


Overview

Basic Information
Taxon OID2124908039 Open in IMG/M
Scaffold IDB3_v_NODE_78965_len_12832_cov_13_489714 Open in IMG/M
Source Dataset NameSoil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Bog Site B4
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)12882
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (84.62%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil → Soil Microbial Communities From Permafrost In Bonanza Creek, Alaska

Source Dataset Sampling Location
Location NameBonanza creek, Alaska, USA
CoordinatesLat. (o)64.7Long. (o)-148.3Alt. (m)Depth (m).3 to .7
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F062295Metagenome131Y

Sequences

Protein IDFamilyRBSSequence
B3_v_00856830F062295N/AMSTLDSFEAKVASSDFQAQGPTVGSIAVKTILGSTSGSVTGTFKVKGGDSAVSITSKVLGITATNDNIVVGDWSYSRTDGGQWTKAPASGKTLQGFVGSGIVLIDQGVAAKFGKQLHQLAVANMAGVDLSVLGITAGPGQENLSVSSLSFWAENDGTPAGLTIEASFDQKIVSTPSHETVTLDISIDTLWGVTITAPVS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.