NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold B3_v_NODE_50504_len_8708_cov_9_940285

Scaffold B3_v_NODE_50504_len_8708_cov_9_940285


Overview

Basic Information
Taxon OID2124908039 Open in IMG/M
Scaffold IDB3_v_NODE_50504_len_8708_cov_9_940285 Open in IMG/M
Source Dataset NameSoil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Bog Site B4
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)8758
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (53.85%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanosarcinales → Methanosarcinaceae → Methanosarcina → unclassified Methanosarcina → Methanosarcina sp. Kolksee(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil → Soil Microbial Communities From Permafrost In Bonanza Creek, Alaska

Source Dataset Sampling Location
Location NameBonanza creek, Alaska, USA
CoordinatesLat. (o)64.7Long. (o)-148.3Alt. (m)Depth (m).3 to .7
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F027066Metagenome196Y

Sequences

Protein IDFamilyRBSSequence
B3_v_00371740F027066N/AMKGGKTRFQQKFTENMFLNSLSIDSIKSTTTIMSLVGCSRSTAKNMLYKLVNEGKVNKIEIEGNGYGWQKVKGD
B3_v_00371750F027066GGAGMKGGKTRFQQKFTEDMFLNALSIDSIKSTTTIMSQVGSSRSTTKNMLYKLVNEXXXXFII

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.