Scaffold B3_v_NODE_29320_len_1247_cov_12_209302

Overview

Basic Information

• Taxon OID: 2124908039
• Scaffold ID: B3_v_NODE_29320_len_1247_cov_12_209302
• Source Dataset Name: Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Bog Site B4
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 1297
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil → Soil Microbial Communities From Permafrost In Bonanza Creek, Alaska

Source Dataset Sampling Location

• Location Name: Bonanza creek, Alaska, USA
• Coordinates
  • Lat. (^o): 64.7
  • Long. (^o): -148.3
  • Depth (m): .3 to .7

Associated Families

Family	Category	Number of Sequences	3D Structure?
F043471	Metagenome / Metatranscriptome	156	Y

Sequences

Protein ID	Family	RBS	Sequence
B3_v_00775050	F043471	AGG	MLKQDNRETRKKTYELPALAVGDVLLVGKFKNRKATITGFSTDENNQPVAHTDKGDHKIFKPRIAKLMPAKLRADGVVR