| Basic Information | |
|---|---|
| Taxon OID | 2124908032 Open in IMG/M |
| Scaffold ID | Perma_A_C_ConsensusfromContig115883 Open in IMG/M |
| Source Dataset Name | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Perma_all |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1298 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil → Soil Microbial Communities From Permafrost In Bonanza Creek, Alaska |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Bonanza creek, Alaska, USA | |||||||
| Coordinates | Lat. (o) | 64.7 | Long. (o) | -148.3 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F050579 | Metagenome / Metatranscriptome | 145 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Perma_A_C_03839310 | F050579 | N/A | KPVTFSGMKKQPDKRSIPTLRDAYKVRGFHVQARIDSYDELKHPAFVVTLDRRSKKRFAVGARKFVAAFTINAGGARAILDAETETFISIFTCTA |
| ⦗Top⦘ |