Scaffold beta3_all_NODE_112957_len_20103_cov_13_227280

Overview

Basic Information

• Taxon OID: 2124908028
• Scaffold ID: beta3_all_NODE_112957_len_20103_cov_13_227280
• Source Dataset Name: Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 20153
• Total Scaffold Genes: 18
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (11.11%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil → Soil Microbial Communities From Permafrost In Bonanza Creek, Alaska

Source Dataset Sampling Location

• Location Name: Bonanza creek, Alaska, USA
• Coordinates
  • Lat. (^o): 64.7
  • Long. (^o): -148.3
  • Depth (m): .3 to .7

Associated Families

Family	Category	Number of Sequences	3D Structure?
F014092	Metagenome / Metatranscriptome	266	Y

Sequences

Protein ID	Family	RBS	Sequence
beta3_all_00598990	F014092	N/A	MKKVLLVLVLIMAVLVVNAQATTTKTTVTKEKALRTVVLAADLQKPITDNIAKDYVGYTVKEAASVTANSIVTYEVVIVKGTDTETLVYDKDGVFVKKLPVPTTPKMK