Scaffold OU_8094

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold OU_8094

Scaffold OU_8094

Overview

Basic Information
Taxon OID	2124908016 Open in IMG/M
Scaffold ID	OU_8094 Open in IMG/M
Source Dataset Name	Sample 642
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Los Alamos National Laboratory
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1326
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Unclassified → Unclassified → Unclassified → Unclassified → → Environmental Microbial Communities From Lanl

Source Dataset Sampling Location
Location Name	USA
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026608	Metagenome / Metatranscriptome	197	Y

Sequences

Protein ID	Family	RBS	Sequence
OU_02357020	F026608	N/A	MARQATARFTDGLSGWLRSALPGVVIDAPDEERGRRDRVVDATISLVAFAISAA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.