Basic Information | |
---|---|
Taxon OID | 2124908016 Open in IMG/M |
Scaffold ID | OU_2_1_1_newblercontig104628 Open in IMG/M |
Source Dataset Name | Sample 642 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Los Alamos National Laboratory |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 768 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Unclassified → Unclassified → Unclassified → Unclassified → → Environmental Microbial Communities From Lanl |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA | |||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F019974 | Metagenome | 226 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
OU_01512580 | F019974 | AGGA | MDASGQFQALVPEPLDAEALRLRRDLEDIHEELLLAILALEEEWLLDDRIAFSLRQRDAA |
⦗Top⦘ |