NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold OU_2_1_1_newblercontig03940

Scaffold OU_2_1_1_newblercontig03940


Overview

Basic Information
Taxon OID2124908016 Open in IMG/M
Scaffold IDOU_2_1_1_newblercontig03940 Open in IMG/M
Source Dataset NameSample 642
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterLos Alamos National Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1073
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Unclassified → Unclassified → Unclassified → Unclassified → → Environmental Microbial Communities From Lanl

Source Dataset Sampling Location
Location NameUSA
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F036647Metagenome169Y

Sequences

Protein IDFamilyRBSSequence
OU_01842870F036647GGGGGMSEGKPKISEHPIASRQVARARAWAALIGFVVAFWLSRRAGLPFPESGARAIAAGIVCRLLAWAALVSLWRQLIPAEIEARRRRAGG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.