| Basic Information | |
|---|---|
| Taxon OID | 2124908016 Open in IMG/M |
| Scaffold ID | OU_12078 Open in IMG/M |
| Source Dataset Name | Sample 642 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Los Alamos National Laboratory |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 741 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Unclassified → Unclassified → Unclassified → Unclassified → → Environmental Microbial Communities From Lanl |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F012066 | Metagenome / Metatranscriptome | 284 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| OU_01902330 | F012066 | GAGG | MGTELGCNWGDYPIGFGYFKSIYAYDLLGRLALFNGTSEQKAMWRHSHRRKVLIELGQPVVARVFDYLLADEVPHVHNGKRWGTHLLGGDEAAYR |
| ⦗Top⦘ |