Scaffold pt300_5827346

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold pt300_5827346

Scaffold pt300_5827346

Overview

Basic Information
Taxon OID	2124908014 Open in IMG/M
Scaffold ID	pt300_5827346 Open in IMG/M
Source Dataset Name	Human Palatine Tonsils microbiome from visit number 1 of subject 763496533
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Los Alamos National Laboratory
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	685
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Unclassified → Human Palatine Tonsil → Human Palatine Tonsil Microbial Communities From Los Alamos National Lab, Usa

Source Dataset Sampling Location
Location Name	St. Louis, MO
Coordinates	Lat. (^o)	38.646	Long. (^o)	-90.224	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F071328	Metagenome	122	N

Sequences

Protein ID	Family	RBS	Sequence
pt300_00912830	F071328	N/A	KLCKHLVLERTIDPKKHQAAAIYLRYSLQLLLKKRRAIRRLGVEKEYVSAILRQYGIHYREYGDNEHRVFFLDTGINLYFSKHDQSSIYIIQRIEFSNEEYRSFILKVLPVKKSEW

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.