Scaffold pt300_3628584

Overview

Basic Information

• Taxon OID: 2124908014
• Scaffold ID: pt300_3628584
• Source Dataset Name: Human Palatine Tonsils microbiome from visit number 1 of subject 763496533
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Los Alamos National Laboratory
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1636
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Oral Cavity → Unclassified → Human Palatine Tonsil → Human Palatine Tonsil Microbial Communities From Los Alamos National Lab, Usa

Source Dataset Sampling Location

• Location Name: St. Louis, MO
• Coordinates
  • Lat. (^o): 38.646
  • Long. (^o): -90.224

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054109	Metagenome	140	N

Sequences

Protein ID	Family	RBS	Sequence
pt300_02462680	F054109	AGGAGG	MVGRPKSKKGTKVHTAFKIYPSDKERAQNMADKLGMSLSAYINKAVLEKVERDEKSEN