NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold pt300_2726882

Scaffold pt300_2726882


Overview

Basic Information
Taxon OID2124908014 Open in IMG/M
Scaffold IDpt300_2726882 Open in IMG/M
Source Dataset NameHuman Palatine Tonsils microbiome from visit number 1 of subject 763496533
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterLos Alamos National Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1489
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Siphoviridae sp. ctHip2(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Unclassified → Human Palatine Tonsil → Human Palatine Tonsil Microbial Communities From Los Alamos National Lab, Usa

Source Dataset Sampling Location
Location NameSt. Louis, MO
CoordinatesLat. (o)38.646Long. (o)-90.224Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F105380Metagenome100N

Sequences

Protein IDFamilyRBSSequence
pt300_02088510F105380GGAMSILQLDASQYVKQGRIFKKFDSNLLDSYMDGRQNNYNINLAELDDQISDGIVYADRNGKMIYKFGAKKIIQTAITNGLEISGLSKDLEMKHYSFWVPDLYFVSFYSFNPNEDLYIAYRRKDEKFICLTNIWPDGSSHEESYFPNGDRLTLKRLCKGSMMSDVSSSDYDAWRNNAVTRASQFVNKFVSARGNSDLDFVGSALRSKVPSHNIKRCAVFLGKITKEQENVNTYEEFIEWTKNTNWLK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.