Scaffold t300_4641151

Overview

Basic Information

• Taxon OID: 2124908013
• Scaffold ID: t300_4641151
• Source Dataset Name: Human Throat microbiome from visit number 1 of subject 763496533
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Los Alamos National Laboratory
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 871
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Oral Cavity → Unclassified → Human → Throat Swab Microbial Communities From Los Alamos National Laboratory, Usa

Source Dataset Sampling Location

• Location Name: St. Louis, MO, USA
• Coordinates
  • Lat. (^o): 38.646
  • Long. (^o): -90.224

Associated Families

Family	Category	Number of Sequences	3D Structure?
F064819	Metagenome	128	N

Sequences

Protein ID	Family	RBS	Sequence
t300_00531460	F064819	AGG	MILKDNQGKDRIKFSDIVRLNKEEPVFVKMKVRISTETMVSEENLDIERSDLEDLTRELKDLCECKIRKFFFQNIDETIEIVFSINDIGAIAVEGKMYDESYMNSINFSFQTDLNGIATFSKEISQELKKI