| Basic Information | |
|---|---|
| Taxon OID | 2124908013 Open in IMG/M |
| Scaffold ID | t300_3931369 Open in IMG/M |
| Source Dataset Name | Human Throat microbiome from visit number 1 of subject 763496533 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Los Alamos National Laboratory |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 516 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Oral Cavity → Unclassified → Human → Throat Swab Microbial Communities From Los Alamos National Laboratory, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | St. Louis, MO, USA | |||||||
| Coordinates | Lat. (o) | 38.646 | Long. (o) | -90.224 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F061925 | Metagenome | 131 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| t300_00523810 | F061925 | AGGA | MSWEYSINLDSEEAVSSVVTDLKICELFSSSTTDYIDWKNPKSIDDIPYDARFYTDKKKTIYIAINSFSKNIFSALKSILAKQNYHLTDCDTDEEV |
| ⦗Top⦘ |