NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold FWIRA_GRAM18401DAOM5

Scaffold FWIRA_GRAM18401DAOM5


Overview

Basic Information
Taxon OID2124908009 Open in IMG/M
Scaffold IDFWIRA_GRAM18401DAOM5 Open in IMG/M
Source Dataset NameSoil microbial communities from sample at FACE Site Metagenome WIR_Amb2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)507
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Face And Otc Sites In Usa

Source Dataset Sampling Location
Location NameWisconsin Rhinelander (WIR)
CoordinatesLat. (o)45.68Long. (o)-89.63Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007385Metagenome / Metatranscriptome352Y

Sequences

Protein IDFamilyRBSSequence
FWIRA_05429380F007385GGAGMKDVYAVLRQKELEQSRLEREVEALRVAAPLLDEEEAENDNQPPMPRAVNETPQPDHSGWQDRGKKHWP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.