Scaffold FWIREl_GJ4R3DH02IR83B

Overview

Basic Information

• Taxon OID: 2124908008
• Scaffold ID: FWIREl_GJ4R3DH02IR83B
• Source Dataset Name: Soil microbial communities from sample at FACE Site Metagenome WIR_Elev2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 515
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Face And Otc Sites In Usa

Source Dataset Sampling Location

• Location Name: Wisconsin Rhinelander (WIR)
• Coordinates
  • Lat. (^o): 45.68
  • Long. (^o): -89.63

Associated Families

Family	Category	Number of Sequences	3D Structure?
F063064	Metagenome / Metatranscriptome	130	Y

Sequences

Protein ID	Family	RBS	Sequence
FWIREl_02553390	F063064	GGAGG	MNVIRQSHGLTRGEILEKMGLKGNKSGEMSVSNALTALTKSNQVRRNEERKYVTA