| Basic Information | |
|---|---|
| Taxon OID | 2124908007 Open in IMG/M |
| Scaffold ID | FWIRElOz_GKZ9IRQ01AEAGN Open in IMG/M |
| Source Dataset Name | Soil microbial communities from sample at FACE Site Metagenome WIR_ElevOz2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 514 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Face And Otc Sites In Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Wisconsin Rhinelander (WIR) | |||||||
| Coordinates | Lat. (o) | 45.68 | Long. (o) | -89.63 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F015669 | Metagenome / Metatranscriptome | 253 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| FWIRElOz_00500160 | F015669 | N/A | EMRFREITRLLVVGAIVTSCAARADALDGAGTCPSDSKLLNGGPTEVFGDGPGTWWGLVTNGLLAAGFVQEADQIAYLNQIFNTSFDNLDDLKAYNLLLVNDTWDENHNGYVCAFQLRGTRAYFHNPYVDLTFFGVTDDRLRKKQALR |
| ⦗Top⦘ |